PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015896021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 299aa    MW: 32686.2 Da    PI: 8.7798
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015896021.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.3e-4040101263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+sss
  XP_015896021.1  40 KEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKRSSS 101
                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-303398IPR003851Zinc finger, Dof-type
PfamPF027011.6E-334298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1344498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPIEDIVV TNTCTPKPGN LAERKARPQK EQALNCPRCN STNTKFCYYN  60
NYSLTQPRYF CKTCRRYWTE GGSLRNIPVG GGSRKNKRSS SSSSQSSHQT SSSKRLPDLV  120
QPHHHQNAKI NINQPQDLNL AFPNISDLVQ LPNNNIENNN NNNNNKNHSL AHVSSSSTTS  180
TTSTSSATHL SALELLNGLT SRGFNSFMPM SVPADPNTAV YASGFPNLQE FKPTLNFSLD  240
GLGGAAYGSL QGVQESNGRL LFPFEDLKQV STTPGIEPSK DQGAETTGYW TGMLGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2022864e-82KT202286.1 Prunus dulcis dof zinc finger protein (dof) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896021.10.0PREDICTED: dof zinc finger protein DOF4.6
SwissprotQ8LAP82e-68DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A061G2Y51e-124A0A061G2Y5_THECC; F-box family protein isoform 1
STRINGPOPTR_0003s14450.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-54Dof family protein